Water activity raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-02-24 and is reviewed periodically as new material appears.
Degree of hydrolysis is commonly estimated by titrating liberated carboxyl groups, measuring soluble nitrogen in trichloroacetic acid, or using o-phthaldialdehyde assays. Molecular weight distribution is often examined by size-exclusion chromatography, sodium dodecyl sulfate polyacrylamide gel electrophoresis, or mass spectrometry. These methods answer different questions: titration estimates bond cleavage, while chromatography describes peptide size ranges. Because no single reference method is universally applied, values reported by different laboratories may not be directly comparable. Method details such as calibration standards and sample preparation strongly influence results.
Routine quality control for hydrolysate powders includes total nitrogen or protein content by Kjeldahl or Dumas combustion, moisture by oven or Karl Fischer titration, ash, and mineral profiles. Microbiological tests typically cover total aerobic counts, yeasts, molds, and specified pathogens according to regional food safety rules. Amino acid analysis can quantify free amino acids and peptide-bound residues after hydrolysis. For products intended for special populations, additional tests may target residual lactose, fat, or specific allergenic proteins. Specifications are set by the manufacturer and may exceed general food-grade requirements.
Whey protein hydrolysate is made by cleaving peptide bonds in whey proteins. The starting material is usually whey protein concentrate or isolate obtained during cheese or casein production. Proteolytic enzymes, acid, or heat can drive hydrolysis, although commercial processes favor controlled enzymatic treatment. The degree of hydrolysis describes the proportion of peptide bonds broken and separates partial from extensive hydrolysates. The resulting powder contains short peptides, free amino acids, residual intact protein, minerals, lactose, and fat in proportions that depend on the starting whey and downstream filtration.
Molecular weight distribution is a central compositional feature, and hydrolysis shifts the population toward lower-mass peptides, often below ten kilodaltons in extensively treated products. Enzyme choice, reaction time, temperature, pH, and enzyme-to-substrate ratio influence the peptide profile. Ultrafiltration or diafiltration may remove enzymes, salts, and smaller molecules. Because peptide size affects solubility, taste, foaming, and digestibility, manufacturers specify molecular weight ranges. However, two hydrolysates with similar average molecular weight can differ in peptide sequence and functional behavior.
Bitterness often increases with hydrolysis because hydrophobic peptides are exposed. Processing strategies therefore include selecting enzymes that cleave at specific sites, using exopeptidases to remove terminal hydrophobic residues, or blending hydrolysates with other ingredients. Allergenicity is another consideration: extensive hydrolysis can reduce IgE-binding epitopes, but it does not guarantee absence of allergenic potential. Regulatory frameworks vary in how they classify hydrolyzed whey for infant formula or sports products. Claims about reduced allergenicity or faster absorption depend on the specific product and study design, and are not uniform across all hydrolysates.
| Property | Value | Notes |
|---|---|---|
| Moisture content | Typically below 6% | Higher moisture increases caking, browning, and microbial risk. |
| Water activity | Often below 0.6 | Low water activity limits microbial growth in dry powders. |
| Typical storage temperature | 15–25 °C | Keep sealed, dry, and away from strong odors and direct light. |
| Protein quantification | Kjeldahl or Dumas combustion | Measures total nitrogen; a conversion factor estimates protein. |
| Peptide size analysis | Size-exclusion chromatography or mass spectrometry | Results depend on method, calibration, and sample preparation. |
Allergen testing is relevant because whey is a milk-derived ingredient. Immunoassays can detect residual milk proteins, but hydrolysis may alter or destroy antibody-binding sites, leading to false negatives or underestimation. Liquid chromatography with tandem mass spectrometry can identify specific peptide markers and is less dependent on intact protein epitopes. Regulatory labeling rules for milk allergens vary by country, and a product described as hydrolyzed is not automatically exempt from allergen declaration. For infants, specialized formulas require strict control of protein molecular weight and sterility, which adds testing beyond routine composition.
Physical properties such as particle size, bulk density, and reconstitution behavior affect handling and finished product quality. Water activity and moisture content influence shelf life; high moisture can promote caking, browning, and microbial growth. Color is monitored because Maillard reactions between peptides and reducing sugars can darken the powder during storage. Taste panels and instrumental methods may assess bitterness, which is a common challenge for hydrolysates. Specifications often include limits for heavy metals, microbiological counts, and residual fat, depending on the intended market.
Whey protein hydrolysate is a dairy ingredient made by treating whey protein concentrate or isolate with proteases that cleave peptide bonds. The resulting mixture contains shorter peptides and free amino acids than intact whey protein. Commercial products vary widely in average peptide length, residual intact protein, lactose, fat, and minerals. The term hydrolysate does not imply a single fixed composition, because enzyme choice, reaction time, pH, and temperature all shape the final peptide distribution. Products are often described by degree of hydrolysis, a percentage estimate of cleaved peptide bonds.
Production begins with pasteurized whey, which is concentrated and sometimes defatted or demineralized before hydrolysis. Food-grade proteases, such as trypsin, chymotrypsin, pepsin, or microbial enzymes, are added under controlled conditions. After a target degree of hydrolysis is reached, the enzymes are inactivated by heat or pH adjustment. The liquor is then clarified, concentrated, and dried, usually by spray drying. Ultrafiltration or diafiltration may remove residual enzymes, salts, or very small peptides, depending on the intended specification.
The peptide profile affects functional behavior more than the total protein content alone. Short peptides can be more soluble across a range of pH values and may form clearer solutions than intact whey proteins. Bitterness often rises with higher degrees of hydrolysis because certain hydrophobic peptides are exposed. Foaming, gelation, and heat stability also change as molecular size decreases. These functional shifts make hydrolysates useful in beverages, clinical nutrition, and specialty foods, though the exact relationship between peptide sequence and sensory or physical properties remains an active area of study.
Advanced peptide profiling uses liquid chromatography coupled with mass spectrometry to identify fragments and assess batch consistency. Amino acid analysis after acid hydrolysis quantifies the building blocks and can reveal deviations from expected composition. Residual enzyme activity may be monitored in products where active enzymes are undesirable. Allergen tests often use immunoassays for beta-lactoglobulin, but hydrolysis can reduce or alter epitope recognition, so negative results do not prove absence of allergenic potential. Physical tests include particle size, bulk density, and reconstitution behavior.
Regulatory and labeling frameworks vary by country. In the United States, whey protein hydrolysate may be regulated as a food ingredient or a dietary supplement ingredient depending on intended use. In the European Union, it falls under general food law, with additional rules for infant formula and foods for special medical purposes. A claim of hypoallergenicity is not established by hydrolysis alone and generally requires clinical evidence. Open questions remain about how degree of hydrolysis relates to bitterness, nitrogen absorption, and residual allergenicity across different products and processing methods.
Quality control for whey protein hydrolysate combines compositional and molecular tests. Protein content is measured by Kjeldahl or Dumas nitrogen determination. Moisture, ash, fat, and lactose are checked with standard food methods. The degree of hydrolysis is estimated by TNBS, OPA, or pH-stat procedures that quantify free amino groups or released protons. Molecular weight distribution is examined by size-exclusion chromatography or SDS-PAGE. These tests describe average peptide size rather than exact peptide sequences, and results depend on standards and calibration.
Whey protein hydrolysate is a dairy ingredient produced when whey proteins are treated with proteolytic enzymes or, less commonly, acid or heat under controlled conditions. The treatment cleaves peptide bonds and yields shorter peptide chains than those found in intact whey protein. The starting material is usually sweet whey or acid whey from cheese manufacture, concentrated by membrane filtration before hydrolysis. The resulting ingredient retains many amino acids from the original protein but differs in molecular size, solubility, and taste profile.
The parent whey proteins include beta-lactoglobulin, alpha-lactalbumin, serum albumin, immunoglobulins, and glycomacropeptide, depending on the whey source. Hydrolysis does not remove these sequences; it fragments them into peptides of varying length. The peptide distribution depends on the enzyme specificity, reaction time, temperature, pH, and enzyme-to-substrate ratio. Because the mixture is heterogeneous, a single molecular weight cannot describe the product. Instead, laboratories report a distribution, often spanning from a few hundred to several thousand daltons.
Whey protein hydrolysate appears in foods and supplements where rapid digestion, low viscosity, or reduced intact-protein content is desired. It is distinct from whey protein isolate and concentrate, which contain largely intact proteins, though hydrolysates can be made from either. In infant formula, extensively hydrolyzed whey is used in some specialty products, while partially hydrolyzed forms appear in other formulations. Human health effects depend on the specific peptide mixture and are not uniform across all hydrolysates.
AS9000 (1997) Aerospace Basic Quality System Standard As aerospace suppliers soon found that ISO 9001 (1994) did not address the specific requirements of their customers, including the DoD, NASA, FAA, and commercial aerospace companies including Boeing, Lockheed Martin, Northrop Grumman, GE Aircraft Engines and Pratt & Whitney, they developed AS9000, based on ISO 9001, to provide a specific quality management standard for the aerospace industry. Prior to the adoption of an aerospace specific quality standard, various corporations typically used ISO 9001 and their own complementary quality documentation/requirements, such as Boeing's D1-9000 or the automotive Q standard. This created a patchwork of competing requirements that were difficult to enforce and/or comply with. The major American aerospace manufacturers collaborated to develop a unified quality standard based on ISO 9001:1994, which led to the creation of AS9000. Following its release, companies like Boeing discontinued their previous quality supplements in favor of complying with AS9000.
The first automated insulin delivery system was known as the Biostator. Currently available AID systems fall into three broad classes based on their capabilities. The first systems released can only halt insulin delivery (predictive low glucose suspend) in response to already low or predicted low glucose. Hybrid Closed Loop systems can modulate delivery both up and down, although users still initiate insulin doses (boluses) for meals and typically "announce" or enter meal information. Fully Closed Loops require no manual insulin delivery actions or announcement for meals. A step forward from threshold suspend systems, predictive low glucose suspend (PLGS) systems use a mathematical model to extrapolate predicted future blood sugar levels based on recent past readings from a CGM. This allows the system to reduce or halt insulin delivery prior to a predicted hypoglycemic event.
After dendritic cells have phagocytosed pathogens, they usually migrate to the vast network of lymph vessels and are carried by lymph flow to the draining lymph nodes. Each lymph node is a collection point where APCs can interact with T cells. During the migration, DCs undergo a process of maturation: they lose most of their ability to further engulf pathogens and they mature by changing surface expression of MHC and co-stimulatory molecules, as well as increased production of cytokines. The internalized antigen is digested into smaller peptides containing epitopes, which are then presented to T cells by the MHC. B cells reside in the lymph node. Once their B cell receptor binds to an antigen, they can interact with activated helper T cells, as described above. A dendritic cell that interacts with an already-activated helper T cell can become licensed. This occurs through the interaction of co-stimulatory molecules including B7 and CD40 on the dendritic cell, with CD28 and CD40 ligand on the T cell. Only licensed dendritic cells are able to activate cytotoxic T cells. T cell licensing of dendritic cells is key for activation of cytotoxic T cells for many pathogens, although the extent to which T cell help is needed may vary. In MHC class I and class II molecules, only certain epitopes of an internalized peptide can be presented. These epitopes are termed immunodominant.
Sources: en.wikipedia.org
In addition, cysteine, tyrosine, and arginine are considered semiessential amino acids, and taurine a semi-essential aminosulfonic acid in children. Some amino acids are conditionally essential for certain ages or medical conditions. Essential amino acids may also vary from species to species. The metabolic pathways that synthesize these monomers are not fully developed. Amino acids are sometimes added to animal feed because some of the components of these feeds, such as soybeans, have low levels of some of the essential amino acids, especially of lysine, methionine, threonine, and tryptophan. Likewise amino acids are used to chelate metal cations in order to improve the absorption of minerals from feed supplements.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Originally, seven such proteins were discovered. Of these, six (BMP2 through BMP7) belong to the Transforming growth factor beta superfamily of proteins. BMP1 is a metalloprotease. Since then, thirteen more BMPs, all of which are in the TGF-beta family, have been discovered, bringing the total to twenty. The current nomenclature only recognizes 13, as many others are put under the growth differentiation factor naming instead.
The linear amino acid sequence of a protein is called the primary structure. The primary structure can be easily determined from the sequence of codons on the DNA gene that codes for it. In most proteins, the primary structure uniquely determines the 3-dimensional structure of a protein in its native environment. An exception is the misfolded prion protein involved in bovine spongiform encephalopathy. This structure is linked to the function of the protein. Additional structural information includes the secondary, tertiary and quaternary structure. A viable general solution to the prediction of the function of a protein remains an open problem. Most efforts have so far been directed towards heuristics that work most of the time.
Sources: en.wikipedia.org
Peptide size is commonly estimated by size-exclusion chromatography, gel electrophoresis, or mass spectrometry. These techniques separate or identify molecules according to mass or hydrodynamic volume. Results depend on calibration and method conditions, so they are best compared within the same analytical protocol.
Clumping usually reflects moisture uptake by hygroscopic peptides and residual lactose. High humidity, temperature fluctuations, and damaged packaging can worsen caking. Sealed containers with desiccant and controlled storage reduce the problem.
No universal reference method exists for all hydrolysates, although several established assays are used. Different methods measure different chemical features and can produce different numerical values. For this reason, specifications should state the assay and laboratory conditions.
Both derive from whey, but hydrolysate has been treated to break peptide bonds, producing shorter peptides. Isolate is filtered to high protein content with much of its original protein structure intact. The two differ in peptide size, taste, and functional properties.